Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries) |
Domain d7bbdc1: 7bbd C:1-152 [398433] Other proteins in same PDB: d7bbda1, d7bbda2, d7bbdc2, d7bbdd_ automated match to d2c2vb_ complexed with zn |
PDB Entry: 7bbd (more details), 2.2 Å
SCOPe Domain Sequences for d7bbdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bbdc1 d.20.1.1 (C:1-152) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe eypmaapkvrfmtkiyhpnvdklgrikldiladkwspalqirtvllsiqallsapnpddp landvaeqwktneaqaietarawtrlyamnni
Timeline for d7bbdc1: