SCOPe 2.08: Domain d7bepe1: 7bep E:333-528

Lineage for d7bepe1 (7bep E:333-528)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
   core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542

4. Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family)
   automatically mapped to Pfam PF09408

5. Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
   part of PfamB PB000266

6. Protein Spike protein S1 [143589] (5 species)

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (118 PDB entries)

8. Domain d7bepe1: 7bep E:333-528 [398424]
   Other proteins in same PDB: d7bepa_, d7bepb1, d7bepc2, d7bepd_, d7bepe2, d7bepf1, d7bepi1, d7bepi2, d7bepl1, d7bepl2
   automated match to d2dd8s1
   complexed with cl, glu, gly, gol, imd, peg, pg4, pge

Details for d7bepe1

PDB Entry: 7bep, 2.61 Å

PDB Description: crystal structure of the receptor binding domain of sars-cov-2 spike glycoprotein in a ternary complex with covox-384 and s309 fabs

PDB Compounds: (E:) Spike glycoprotein

SCOPe Domain Sequences for d7bepe1:

Sequence; same for both SEQRES and ATOM records:

>d7bepe1 d.318.1.1 (E:333-528) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
tnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcf
tnvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvggnynyl
yrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvv
lsfellhapatvcgkk

Timeline for d7bepe1:

• d7bepe1 first appeared in SCOPe 2.07