Lineage for d7bbfa_ (7bbf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939083Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries)
  8. 2939092Domain d7bbfa_: 7bbf A: [398421]
    Other proteins in same PDB: d7bbfb_, d7bbfc_, d7bbfe_, d7bbff_, d7bbfh_, d7bbfi_
    automated match to d2c2vb_

Details for d7bbfa_

PDB Entry: 7bbf (more details), 2.54 Å

PDB Description: crystal structure of ubiquitin charged ube2n (ube2n~ub) in complex with ube2v2
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d7bbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bbfa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgrikldiladkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnni

SCOPe Domain Coordinates for d7bbfa_:

Click to download the PDB-style file with coordinates for d7bbfa_.
(The format of our PDB-style files is described here.)

Timeline for d7bbfa_: