Lineage for d1gczc1 (1gcz C:1-114)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2526467Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2526468Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2526662Family d.80.1.3: MIF-related [55339] (2 proteins)
    automatically mapped to Pfam PF01187
  6. 2526679Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2526685Species Human (Homo sapiens) [TaxId:9606] [55341] (88 PDB entries)
  8. 2526742Domain d1gczc1: 1gcz C:1-114 [39842]
    Other proteins in same PDB: d1gcza2, d1gczc2
    complexed with cit, so4, yz9

Details for d1gczc1

PDB Entry: 1gcz (more details), 1.9 Å

PDB Description: macrophage migration inhibitory factor (mif) complexed with inhibitor.
PDB Compounds: (C:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d1gczc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gczc1 d.80.1.3 (C:1-114) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOPe Domain Coordinates for d1gczc1:

Click to download the PDB-style file with coordinates for d1gczc1.
(The format of our PDB-style files is described here.)

Timeline for d1gczc1: