Lineage for d1gczb_ (1gcz B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33714Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
  4. 33715Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 33737Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 33743Protein Microphage migration inhibition factor (MIF) [55340] (3 species)
  7. 33744Species Human (Homo sapiens) [TaxId:9606] [55341] (7 PDB entries)
  8. 33752Domain d1gczb_: 1gcz B: [39841]

Details for d1gczb_

PDB Entry: 1gcz (more details), 1.9 Å

PDB Description: macrophage migration inhibitory factor (mif) complexed with inhibitor.

SCOP Domain Sequences for d1gczb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gczb_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens)}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOP Domain Coordinates for d1gczb_:

Click to download the PDB-style file with coordinates for d1gczb_.
(The format of our PDB-style files is described here.)

Timeline for d1gczb_: