Lineage for d1gcza_ (1gcz A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915130Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 1915131Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 1915295Family d.80.1.3: MIF-related [55339] (2 proteins)
    automatically mapped to Pfam PF01187
  6. 1915312Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 1915318Species Human (Homo sapiens) [TaxId:9606] [55341] (59 PDB entries)
  8. 1915418Domain d1gcza_: 1gcz A: [39840]
    complexed with cit, so4, yz9

Details for d1gcza_

PDB Entry: 1gcz (more details), 1.9 Å

PDB Description: macrophage migration inhibitory factor (mif) complexed with inhibitor.
PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d1gcza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfalehh

SCOPe Domain Coordinates for d1gcza_:

Click to download the PDB-style file with coordinates for d1gcza_.
(The format of our PDB-style files is described here.)

Timeline for d1gcza_: