Lineage for d1gifc_ (1gif C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) 
Family d.80.1.3: MIF-related [55339] (2 proteins) Protein Microphage migration inhibition factor (MIF) [55340] (3 species) Species Human (Homo sapiens) [TaxId:9606] [55341] (7 PDB entries) 
Domain d1gifc_: 1gif C: [39839]
Details for d1gifc_
PDB Entry: 1gif (more details), 1.9 Å
PDB Description: human glycosylation-inhibiting factor
SCOP Domain Sequences for d1gifc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gifc_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens)}
mpmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
SCOP Domain Coordinates for d1gifc_:
Click to download the PDB-style file with coordinates for d1gifc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gifc_:
- d1gifc_ appears in SCOP 1.57
- d1gifc_ appears in the current release, SCOPe 2.08
View in 3D
