Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (31 species) not a true protein |
Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries) |
Domain d7aq4b2: 7aq4 B:508-638 [398388] Other proteins in same PDB: d7aq4a1, d7aq4b1, d7aq4b3 automated match to d3sbqa2 complexed with b3p, ca, cl, cua, cuz, fmt, k, na, trs, zn; mutant |
PDB Entry: 7aq4 (more details), 1.71 Å
SCOPe Domain Sequences for d7aq4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7aq4b2 b.6.1.0 (B:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]} kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde vtvtitnidqiedvsegfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm emvgrmmvepa
Timeline for d7aq4b2: