Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (6 families) |
Family d.80.1.3: MIF-related [55339] (2 proteins) |
Protein Microphage migration inhibition factor (MIF) [55340] (5 species) synonym: glycosylation-inhibiting factor (GIF) |
Species Human (Homo sapiens) [TaxId:9606] [55341] (11 PDB entries) |
Domain d1gifb_: 1gif B: [39838] |
PDB Entry: 1gif (more details), 1.9 Å
SCOP Domain Sequences for d1gifb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gifb_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]} mpmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
Timeline for d1gifb_: