SCOP 1.73: Domain d1gifb_: 1gif B:

Lineage for d1gifb_ (1gif B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (6 families)

5. Family d.80.1.3: MIF-related [55339] (2 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (5 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (11 PDB entries)

8. Domain d1gifb_: 1gif B: [39838]

Details for d1gifb_

PDB Entry: 1gif, 1.9 Å

PDB Description: human glycosylation-inhibiting factor

PDB Compounds: (B:) glycosylation-inhibiting factor

SCOP Domain Sequences for d1gifb_:

Sequence; same for both SEQRES and ATOM records:

>d1gifb_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
mpmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

Timeline for d1gifb_:

• d1gifb_ first appeared (with stable ids) in SCOP 1.55
  
• d1gifb_ appears in SCOP 1.71
  
• d1gifb_ appears in SCOP 1.75
  
• d1gifb_ appears in the current release, SCOPe 2.08