Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein automated matches [227027] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries) |
Domain d7b5qi1: 7b5q I:1-161 [398365] Other proteins in same PDB: d7b5qj_ automated match to d1kxua1 complexed with i74 |
PDB Entry: 7b5q (more details), 2.5 Å
SCOPe Domain Sequences for d7b5qi1:
Sequence, based on SEQRES records: (download)
>d7b5qi1 a.74.1.1 (I:1-161) automated matches {Human (Homo sapiens) [TaxId: 9606]} myhnssqkrhwtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyy ekrllefcsvfkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnv sspqfvgnlresplgqekaleqileyellliqqlnfhlivh
>d7b5qi1 a.74.1.1 (I:1-161) automated matches {Human (Homo sapiens) [TaxId: 9606]} myhnssqkrhwtfsseeqlarlradanrkfrckavangpndpvflepheemtlckyyekr llefcsvfkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvssp qfvgnlresplgqekaleqileyellliqqlnfhlivh
Timeline for d7b5qi1: