Lineage for d7b5qi1 (7b5q I:1-161)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331672Protein automated matches [227027] (3 species)
    not a true protein
  7. 2331702Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)
  8. 2331731Domain d7b5qi1: 7b5q I:1-161 [398365]
    Other proteins in same PDB: d7b5qj_
    automated match to d1kxua1
    complexed with i74

Details for d7b5qi1

PDB Entry: 7b5q (more details), 2.5 Å

PDB Description: cryo-em structure of the human cak bound to icec0942 (phenix-opls3e)
PDB Compounds: (I:) Cyclin-H

SCOPe Domain Sequences for d7b5qi1:

Sequence, based on SEQRES records: (download)

>d7b5qi1 a.74.1.1 (I:1-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myhnssqkrhwtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyy
ekrllefcsvfkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnv
sspqfvgnlresplgqekaleqileyellliqqlnfhlivh

Sequence, based on observed residues (ATOM records): (download)

>d7b5qi1 a.74.1.1 (I:1-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myhnssqkrhwtfsseeqlarlradanrkfrckavangpndpvflepheemtlckyyekr
llefcsvfkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvssp
qfvgnlresplgqekaleqileyellliqqlnfhlivh

SCOPe Domain Coordinates for d7b5qi1:

Click to download the PDB-style file with coordinates for d7b5qi1.
(The format of our PDB-style files is described here.)

Timeline for d7b5qi1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7b5qi2
View in 3D
Domains from other chains:
(mouse over for more information)
d7b5qj_