Lineage for d7ag8a2 (7ag8 A:433-740)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720799Species Mycobacterium tuberculosis [TaxId:1773] [254876] (5 PDB entries)
  8. 2720809Domain d7ag8a2: 7ag8 A:433-740 [398353]
    automated match to d2ccda2
    complexed with hem

Details for d7ag8a2

PDB Entry: 7ag8 (more details), 2.68 Å

PDB Description: cryo-em structure of wild-type katg from m. tuberculosis
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d7ag8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ag8a2 a.93.1.0 (A:433-740) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
kqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgga
nggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaai
ekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlld
kanlltlsapemtvlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepsp
addgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvm
nldrfdvr

SCOPe Domain Coordinates for d7ag8a2:

Click to download the PDB-style file with coordinates for d7ag8a2.
(The format of our PDB-style files is described here.)

Timeline for d7ag8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7ag8a1