Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) |
Domain d7av0a3: 7av0 A:461-610 [398351] Other proteins in same PDB: d7av0a1, d7av0a2 automated match to d3u9wa3 complexed with act, imd, rzb, yb, zn |
PDB Entry: 7av0 (more details), 1.9 Å
SCOPe Domain Sequences for d7av0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7av0a3 a.118.1.0 (A:461-610) automated matches {Human (Homo sapiens) [TaxId: 9606]} dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks hdqavrtyqehkasmhpvtamlvgkdlkvd
Timeline for d7av0a3: