Class b: All beta proteins [48724] (180 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.0: automated matches [191353] (1 protein) not a true family |
Protein automated matches [190378] (9 species) not a true protein |
Species Human adenovirus 56 [TaxId:880565] [398205] (1 PDB entry) |
Domain d7ajpj_: 7ajp J: [398272] automated match to d1qhva_ complexed with edo, gol, no3, pge |
PDB Entry: 7ajp (more details), 1.38 Å
SCOPe Domain Sequences for d7ajpj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ajpj_ b.21.1.0 (J:) automated matches {Human adenovirus 56 [TaxId: 880565]} dkrtlwttpdtspnckidqdkdskltlvltkcgsqilanvslivvagkykiinnntqpal kgftikllfdengvlmessnlgksywnfrnensimstayekaigfmpnlvaypkptagsk kyardivygniylggkpdqpvtikttfnqetgceysitfdfswaktyvnvefettsftfs yiaqe
Timeline for d7ajpj_: