Lineage for d7ajpi_ (7ajp I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777097Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2777098Protein automated matches [190378] (9 species)
    not a true protein
  7. 2777151Species Human adenovirus 56 [TaxId:880565] [398205] (1 PDB entry)
  8. 2777160Domain d7ajpi_: 7ajp I: [398253]
    automated match to d1qhva_
    complexed with edo, gol, no3, pge

Details for d7ajpi_

PDB Entry: 7ajp (more details), 1.38 Å

PDB Description: crystal structure of human adenovirus 56 fiber knob
PDB Compounds: (I:) Fiber

SCOPe Domain Sequences for d7ajpi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ajpi_ b.21.1.0 (I:) automated matches {Human adenovirus 56 [TaxId: 880565]}
edkrtlwttpdtspnckidqdkdskltlvltkcgsqilanvslivvagkykiinnntqpa
lkgftikllfdengvlmessnlgksywnfrnensimstayekaigfmpnlvaypkptags
kkyardivygniylggkpdqpvtikttfnqetgceysitfdfswaktyvnvefettsftf
syiaqe

SCOPe Domain Coordinates for d7ajpi_:

Click to download the PDB-style file with coordinates for d7ajpi_.
(The format of our PDB-style files is described here.)

Timeline for d7ajpi_: