Lineage for d7a7aa2 (7a7a A:433-739)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333804Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2333805Protein automated matches [191104] (14 species)
    not a true protein
  7. 2333897Species Mycobacterium tuberculosis [TaxId:1773] [254876] (5 PDB entries)
  8. 2333911Domain d7a7aa2: 7a7a A:433-739 [398225]
    automated match to d2ccda2
    complexed with hem

Details for d7a7aa2

PDB Entry: 7a7a (more details), 3.08 Å

PDB Description: cryo-em structure of w107r after heme uptake (2heme molecules) katg from m. tuberculosis
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d7a7aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a7aa2 a.93.1.0 (A:433-739) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
kqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgga
nggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaai
ekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlld
kanlltlsapemtvlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepsp
addgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvm
nldrfdv

SCOPe Domain Coordinates for d7a7aa2:

Click to download the PDB-style file with coordinates for d7a7aa2.
(The format of our PDB-style files is described here.)

Timeline for d7a7aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7a7aa1