Lineage for d7a63a_ (7a63 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603297Species Stenotrophomonas maltophilia [TaxId:40324] [186946] (8 PDB entries)
  8. 2603299Domain d7a63a_: 7a63 A: [398207]
    automated match to d5evda_
    complexed with r3n, so4, zn

Details for d7a63a_

PDB Entry: 7a63 (more details), 1.57 Å

PDB Description: crystal structure of l1 with hydrolyzed faropenem (imine, ring-closed form)
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d7a63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a63a_ d.157.1.1 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d7a63a_:

Click to download the PDB-style file with coordinates for d7a63a_.
(The format of our PDB-style files is described here.)

Timeline for d7a63a_: