![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) ![]() |
![]() | Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (2 proteins) dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers) |
![]() | Protein 4-oxalocrotonate tautomerase [55333] (2 species) |
![]() | Species Pseudomonas sp., DmpI [TaxId:306] [55334] (1 PDB entry) |
![]() | Domain d1otfa_: 1otf A: [39820] |
PDB Entry: 1otf (more details), 1.9 Å
SCOP Domain Sequences for d1otfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otfa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase {Pseudomonas sp., DmpI} piaqlyiiegrtdeqketlirqvseamansldaplervrvlitempknhfgiggepask
Timeline for d1otfa_: