Lineage for d1clic1 (1cli C:2005-2170)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606051Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 606282Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) (S)
  5. 606283Family d.79.4.1: PurM N-terminal domain-like [55327] (4 proteins)
  6. 606284Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (1 species)
  7. 606285Species Escherichia coli [TaxId:562] [55329] (1 PDB entry)
  8. 606288Domain d1clic1: 1cli C:2005-2170 [39818]
    Other proteins in same PDB: d1clia2, d1clib2, d1clic2, d1clid2

Details for d1clic1

PDB Entry: 1cli (more details), 2.5 Å

PDB Description: x-ray crystal structure of aminoimidazole ribonucleotide synthetase (purm), from the e. coli purine biosynthetic pathway, at 2.5 a resolution

SCOP Domain Sequences for d1clic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clic1 d.79.4.1 (C:2005-2170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Escherichia coli}
tslsykdagvdidagnalvgrikgvvkktrrpevmgglggfgalcalpqkyrepvlvsgt
dgvgtklrlamdlkrhdtigidlvamcvndlvvqgaeplffldyyatgkldvdtasavis
giaegclqsgcslvggetaempgmyhgedydvagfcvgvvekseii

SCOP Domain Coordinates for d1clic1:

Click to download the PDB-style file with coordinates for d1clic1.
(The format of our PDB-style files is described here.)

Timeline for d1clic1: