Lineage for d7a9ad_ (7a9a D:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641489Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 2641490Protein automated matches [232943] (4 species)
    not a true protein
  7. 2641506Species Mycobacterium tuberculosis [TaxId:83332] [398154] (1 PDB entry)
  8. 2641510Domain d7a9ad_: 7a9a D: [398159]
    automated match to d1s24a_
    complexed with cl, edo, fe, gol, peg, zn

Details for d7a9ad_

PDB Entry: 7a9a (more details), 1.17 Å

PDB Description: crystal structure of rubredoxin b (rv3250c) from mycobacterium tuberculosis
PDB Compounds: (D:) rubredoxin

SCOPe Domain Sequences for d7a9ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a9ad_ g.41.5.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mndyklfrciqcgfeydealgwpedgiaagtrwddipddwscpdcgaaksdfemvevars

SCOPe Domain Coordinates for d7a9ad_:

Click to download the PDB-style file with coordinates for d7a9ad_.
(The format of our PDB-style files is described here.)

Timeline for d7a9ad_: