Lineage for d7aaaa1 (7aaa A:662-796)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712204Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2712205Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2712230Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2712231Protein automated matches [226964] (2 species)
    not a true protein
  7. 2712235Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries)
  8. 2712247Domain d7aaaa1: 7aaa A:662-796 [398147]
    Other proteins in same PDB: d7aaaa2, d7aaab2
    automated match to d4hhyd1
    complexed with dms, edo, so4

Details for d7aaaa1

PDB Entry: 7aaa (more details), 1.74 Å

PDB Description: crystal structure of the catalytic domain of human parp1 (apo)
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d7aaaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7aaaa1 a.41.1.0 (A:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

SCOPe Domain Coordinates for d7aaaa1:

Click to download the PDB-style file with coordinates for d7aaaa1.
(The format of our PDB-style files is described here.)

Timeline for d7aaaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7aaaa2