![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (3 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins) |
![]() | Protein Spliceosomal 15.5kd protein [55321] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55322] (1 PDB entry) |
![]() | Domain d1e7kb_: 1e7k B: [39814] |
PDB Entry: 1e7k (more details), 2.9 Å
SCOP Domain Sequences for d1e7kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7kb_ d.79.3.1 (B:) Spliceosomal 15.5kd protein {Human (Homo sapiens)} vnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaeplei ilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsier llv
Timeline for d1e7kb_: