SCOP 1.71: Domain d1e7ka_: 1e7k A:

Lineage for d1e7ka_ (1e7k A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Spliceosomal 15.5kd protein [55321] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55322] (1 PDB entry)

8. Domain d1e7ka_: 1e7k A: [39813]

Details for d1e7ka_

PDB Entry: 1e7k, 2.9 Å

PDB Description: crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment

SCOP Domain Sequences for d1e7ka_:

Sequence; same for both SEQRES and ATOM records:

>d1e7ka_ d.79.3.1 (A:) Spliceosomal 15.5kd protein {Human (Homo sapiens)}
advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
erllv

Timeline for d1e7ka_:

• d1e7ka_ first appeared (with stable ids) in SCOP 1.55
  
• d1e7ka_ appears in SCOP 1.69
  
• d1e7ka_ appears in SCOP 1.73
  
• d1e7ka_ appears in the current release, SCOPe 2.08