Lineage for d1e7ka_ (1e7k A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506461Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 506595Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 506596Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 506644Protein Spliceosomal 15.5kd protein [55321] (1 species)
  7. 506645Species Human (Homo sapiens) [TaxId:9606] [55322] (1 PDB entry)
  8. 506646Domain d1e7ka_: 1e7k A: [39813]

Details for d1e7ka_

PDB Entry: 1e7k (more details), 2.9 Å

PDB Description: crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment

SCOP Domain Sequences for d1e7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ka_ d.79.3.1 (A:) Spliceosomal 15.5kd protein {Human (Homo sapiens)}
advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
erllv

SCOP Domain Coordinates for d1e7ka_:

Click to download the PDB-style file with coordinates for d1e7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1e7ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e7kb_