Lineage for d1e7ka_ (1e7k A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.3: L30e-like [55315] (4 families) 
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) 
Protein Spliceosomal 15.5kd protein [55321] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55322] (3 PDB entries) 
Domain d1e7ka_: 1e7k A: [39813]
Details for d1e7ka_
PDB Entry: 1e7k (more details), 2.9 Å
PDB Description: crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
PDB Compounds: (A:) 15.5 kd RNA binding proteinSCOPe Domain Sequences for d1e7ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7ka_ d.79.3.1 (A:) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]}
advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
erllv
SCOPe Domain Coordinates for d1e7ka_:
Click to download the PDB-style file with coordinates for d1e7ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e7ka_:
- d1e7ka_ first appeared (with stable ids) in SCOP 1.55
- d1e7ka_ appears in SCOPe 2.07
View in 3D
