SCOPe 2.08: Domain d7a8na1: 7a8n A:3-234

Lineage for d7a8na1 (7a8n A:3-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d7a8na1: 7a8n A:3-234 [398112]
   Other proteins in same PDB: d7a8na2
   automated match to d3srya_

Details for d7a8na1

PDB Entry: 7a8n, 2.1 Å

PDB Description: rsgreen0.7-k206a-n205l in the green-on state

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d7a8na1:

Sequence; same for both SEQRES and ATOM records:

>d7a8na1 d.22.1.1 (A:3-234) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlgygvlcfarypdhmkqhdffksampegyvqertisfkddgyyktraevkfegdtlvnr
ielkgidfkedgnilghkleynfnshnayitadkqkngiksnfkirhnvedgsvqladhy
qqntpigdgpvllpdnhylstqlalskdpnekrdhmvllefvtaagitlgmd

Timeline for d7a8na1:

• d7a8na1 first appeared in SCOPe 2.07