Lineage for d1ck2a_ (1ck2 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525848Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2525849Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2525850Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species)
  7. 2525851Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55318] (4 PDB entries)
    Uniprot P14120
  8. 2525853Domain d1ck2a_: 1ck2 A: [39809]

Details for d1ck2a_

PDB Entry: 1ck2 (more details)

PDB Description: yeast (saccharomyces cerevisiae) ribosomal protein l30
PDB Compounds: (A:) 60s ribosomal protein l30

SCOPe Domain Sequences for d1ck2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck2a_ d.79.3.1 (A:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla

SCOPe Domain Coordinates for d1ck2a_:

Click to download the PDB-style file with coordinates for d1ck2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ck2a_: