Lineage for d6zq4h1 (6zq4 H:67-325)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2884896Species Chaetomium thermophilum [TaxId:759272] [226535] (6 PDB entries)
  8. 2884915Domain d6zq4h1: 6zq4 H:67-325 [398050]
    Other proteins in same PDB: d6zq4a3, d6zq4b3, d6zq4c3, d6zq4d3, d6zq4e3, d6zq4f3, d6zq4g3, d6zq4h3
    automated match to d1glfo1
    complexed with gol, po4

Details for d6zq4h1

PDB Entry: 6zq4 (more details), 2.02 Å

PDB Description: crystal structure of chaetomium thermophilum glycerol kinase in complex with substrate in p1 space group
PDB Compounds: (H:) Glycerol kinase-like protein

SCOPe Domain Sequences for d6zq4h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zq4h1 c.55.1.0 (H:67-325) automated matches {Chaetomium thermophilum [TaxId: 759272]}
fvgsidqgttssrflifngegnpvashqiefenlypksgwheqdpyellnsvqqcidgam
hkfaslgyskeniraigitnqrettvvwdsvtgeplhnaivwpdtrtsalvrelkarqsa
dsllelcglplstypssvkllwliqnvdavkqayeegrlafgtvdswliyklnggaqaer
pihvtdstnasrtmfmnlrtlqyddkllgffgidrnkiklpkivpssdpeafgkvatgal
agvpiagclgdqssalvgq

SCOPe Domain Coordinates for d6zq4h1:

Click to download the PDB-style file with coordinates for d6zq4h1.
(The format of our PDB-style files is described here.)

Timeline for d6zq4h1: