Lineage for d1cn7a_ (1cn7 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330739Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 330850Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 330851Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 330852Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species)
  7. 330857Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55318] (8 PDB entries)
  8. 330859Domain d1cn7a_: 1cn7 A: [39805]

Details for d1cn7a_

PDB Entry: 1cn7 (more details)

PDB Description: Yeast ribosomal protein L30
PDB Compounds: (A:)

SCOP Domain Sequences for d1cn7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cn7a_ d.79.3.1 (A:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae)}
apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla

SCOP Domain Coordinates for d1cn7a_:

Click to download the PDB-style file with coordinates for d1cn7a_.
(The format of our PDB-style files is described here.)

Timeline for d1cn7a_: