Lineage for d1tubb2 (1tub B:246-437)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914315Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1914316Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1914409Protein Tubulin beta-subunit [55313] (2 species)
  7. 1914419Species Pig (Sus scrofa) [TaxId:9823] [55314] (3 PDB entries)
  8. 1914420Domain d1tubb2: 1tub B:246-437 [39804]
    Other proteins in same PDB: d1tuba1, d1tuba2, d1tubb1
    complexed with gdp, gtp, txl

Details for d1tubb2

PDB Entry: 1tub (more details), 3.7 Å

PDB Description: tubulin alpha-beta dimer, electron diffraction
PDB Compounds: (B:) tubulin

SCOPe Domain Sequences for d1tubb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tubb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

SCOPe Domain Coordinates for d1tubb2:

Click to download the PDB-style file with coordinates for d1tubb2.
(The format of our PDB-style files is described here.)

Timeline for d1tubb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tubb1