Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
Protein Tubulin beta-subunit [55313] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [55314] (1 PDB entry) |
Domain d1tubb2: 1tub B:246-437 [39804] Other proteins in same PDB: d1tuba1, d1tuba2, d1tubb1 complexed with gdp, gtp, txl |
PDB Entry: 1tub (more details), 3.7 Å
SCOPe Domain Sequences for d1tubb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tubb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqd
Timeline for d1tubb2: