SCOPe 2.01: Domain d1tubb2: 1tub B:246-437

Lineage for d1tubb2 (1tub B:246-437)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Tubulin beta-subunit [55313] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [55314] (1 PDB entry)

8. Domain d1tubb2: 1tub B:246-437 [39804]
   Other proteins in same PDB: d1tuba1, d1tuba2, d1tubb1
   complexed with gdp, gtp, txl

Details for d1tubb2

PDB Entry: 1tub, 3.7 Å

PDB Description: tubulin alpha-beta dimer, electron diffraction

PDB Compounds: (B:) tubulin

SCOPe Domain Sequences for d1tubb2:

Sequence; same for both SEQRES and ATOM records:

>d1tubb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

Timeline for d1tubb2:

• d1tubb2 first appeared (with stable ids) in SCOP 1.55
  
• d1tubb2 appears in SCOP 1.75
  
• d1tubb2 appears in SCOPe 2.02
  
• d1tubb2 appears in the current release, SCOPe 2.08