Lineage for d1tubb2 (1tub B:246-437)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33616Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)
  4. 33673Superfamily d.79.2: Tubulin, C-terminal domain [55307] (1 family) (S)
  5. 33674Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 33681Protein Tubulin beta-subunit [55313] (1 species)
  7. 33682Species Pig (Sus scrofa) [TaxId:9823] [55314] (1 PDB entry)
  8. 33683Domain d1tubb2: 1tub B:246-437 [39804]
    Other proteins in same PDB: d1tuba1, d1tuba2, d1tubb1

Details for d1tubb2

PDB Entry: 1tub (more details), 3.7 Å

PDB Description: tubulin alpha-beta dimer, electron diffraction

SCOP Domain Sequences for d1tubb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tubb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Sus scrofa)}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

SCOP Domain Coordinates for d1tubb2:

Click to download the PDB-style file with coordinates for d1tubb2.
(The format of our PDB-style files is described here.)

Timeline for d1tubb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tubb1