Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Chaetomium thermophilum [TaxId:759272] [226535] (6 PDB entries) |
Domain d6zq7a2: 6zq7 A:326-582 [398030] Other proteins in same PDB: d6zq7a3 automated match to d3ezwe2 complexed with edo, gol |
PDB Entry: 6zq7 (more details), 2.42 Å
SCOPe Domain Sequences for d6zq7a2:
Sequence, based on SEQRES records: (download)
>d6zq7a2 c.55.1.0 (A:326-582) automated matches {Chaetomium thermophilum [TaxId: 759272]} cgfspgqakntygtgcfllynvgtepviskygllatvaydfgrgrkpvyalegsiavaga gitflmnnlgfapkpseinalaesvldnggvvfvtafsglfapywiddakgtlfgitqht tkghiaratleatcyqtraildamekdsghkleslavdgglsasdlcmqtqadisgipvd rprmrettalgaaiaaglatgvwreldhvkesiaggangngkknarevfypkmdrkkaer lfrkweqavemsrgwvr
>d6zq7a2 c.55.1.0 (A:326-582) automated matches {Chaetomium thermophilum [TaxId: 759272]} cgfspgqakntygtgcfllynvgtepviskygllatvaydfgrgrkpvyalegsiavaga gitflmnnlgfapkpseinalaesvldnggvvfvtafsglfapywiddakgtlfgitqht tkghiaratleatcyqtraildamekdsghkleslavdgglsasdlcmqtqadisgipvd rprmrettalgaaiaaglatgvwreldhvkesiaggrevfypkmdrkkaerlfrkweqav emsrgwvr
Timeline for d6zq7a2: