Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Tubulin alpha-subunit [55311] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [55312] (3 PDB entries) |
Domain d1tuba2: 1tub A:246-440 [39803] Other proteins in same PDB: d1tuba1, d1tubb1, d1tubb2 complexed with gdp, gtp, txl |
PDB Entry: 1tub (more details), 3.7 Å
SCOPe Domain Sequences for d1tuba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuba2 d.79.2.1 (A:246-440) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d1tuba2: