SCOPe 2.04: Domain d1tuba2: 1tub A:246-440

Lineage for d1tuba2 (1tub A:246-440)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Tubulin alpha-subunit [55311] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [55312] (3 PDB entries)

8. Domain d1tuba2: 1tub A:246-440 [39803]
   Other proteins in same PDB: d1tuba1, d1tubb1, d1tubb2
   complexed with gdp, gtp, txl

Details for d1tuba2

PDB Entry: 1tub, 3.7 Å

PDB Description: tubulin alpha-beta dimer, electron diffraction

PDB Compounds: (A:) tubulin

SCOPe Domain Sequences for d1tuba2:

Sequence; same for both SEQRES and ATOM records:

>d1tuba2 d.79.2.1 (A:246-440) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d1tuba2:

• d1tuba2 first appeared (with stable ids) in SCOP 1.55
  
• d1tuba2 appears in SCOPe 2.03
  
• d1tuba2 appears in SCOPe 2.05
  
• d1tuba2 appears in the current release, SCOPe 2.08