Lineage for d6tl6a_ (6tl6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2812758Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2812759Protein automated matches [191011] (16 species)
    not a true protein
  7. 2812843Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries)
  8. 2812864Domain d6tl6a_: 6tl6 A: [398024]
    automated match to d1bzma_
    complexed with gol, mue, zn

Details for d6tl6a_

PDB Entry: 6tl6 (more details), 2.15 Å

PDB Description: three dimensional structure of human carbonic anhydrase ix in complex with sulfonamide
PDB Compounds: (A:) Carbonic anhydrase 9

SCOPe Domain Sequences for d6tl6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tl6a_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
fsryfqyegslttppcaqgviwtvfqqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
lngrvieasfp

SCOPe Domain Coordinates for d6tl6a_:

Click to download the PDB-style file with coordinates for d6tl6a_.
(The format of our PDB-style files is described here.)

Timeline for d6tl6a_: