SCOPe 2.03: Domain d1fsza2: 1fsz A:232-356

Lineage for d1fsza2 (1fsz A:232-356)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries)
   Uniprot Q57816 23-360

8. Domain d1fsza2: 1fsz A:232-356 [39802]
   Other proteins in same PDB: d1fsza1
   complexed with gdp

Details for d1fsza2

PDB Entry: 1fsz, 2.8 Å

PDB Description: crystal structure of the cell-division protein ftsz at 2.8a resolution

PDB Compounds: (A:) ftsz

SCOPe Domain Sequences for d1fsza2:

Sequence; same for both SEQRES and ATOM records:

>d1fsza2 d.79.2.1 (A:232-356) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krkkl

Timeline for d1fsza2:

• d1fsza2 first appeared (with stable ids) in SCOP 1.55, called d1fsz_2
  
• d1fsza2 appears in SCOPe 2.02
  
• d1fsza2 appears in SCOPe 2.04
  
• d1fsza2 appears in the current release, SCOPe 2.08