![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
![]() | Protein Cell-division protein FtsZ [55309] (4 species) |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (6 PDB entries) |
![]() | Domain d1fsza2: 1fsz A:232-356 [39802] Other proteins in same PDB: d1fsza1 complexed with gdp |
PDB Entry: 1fsz (more details), 2.8 Å
SCOP Domain Sequences for d1fsza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsza2 d.79.2.1 (A:232-356) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl krkkl
Timeline for d1fsza2: