| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
| Protein Cell-division protein FtsZ [55309] (3 species) |
| Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (1 PDB entry) |
| Domain d1fsz_2: 1fsz 232-356 [39802] Other proteins in same PDB: d1fsz_1 |
PDB Entry: 1fsz (more details), 2.8 Å
SCOP Domain Sequences for d1fsz_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsz_2 d.79.2.1 (232-356) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krkkl
Timeline for d1fsz_2: