SCOPe 2.08: Domain d6zq6a1: 6zq6 A:67-325

Lineage for d6zq6a1 (6zq6 A:67-325)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:759272] [226535] (6 PDB entries)

8. Domain d6zq6a1: 6zq6 A:67-325 [398015]
   Other proteins in same PDB: d6zq6a3, d6zq6b3, d6zq6c3, d6zq6d3
   automated match to d1glfo1
   complexed with act, gol

Details for d6zq6a1

PDB Entry: 6zq6, 2.3 Å

PDB Description: crystal structure of chaetomium thermophilum glycerol kinase in complex with glycerol in p21212 space group

PDB Compounds: (A:) Glycerol kinase-like protein

SCOPe Domain Sequences for d6zq6a1:

Sequence; same for both SEQRES and ATOM records:

>d6zq6a1 c.55.1.0 (A:67-325) automated matches {Chaetomium thermophilum [TaxId: 759272]}
fvgsidqgttssrflifngegnpvashqiefenlypksgwheqdpyellnsvqqcidgam
hkfaslgyskeniraigitnqrettvvwdsvtgeplhnaivwpdtrtsalvrelkarqsa
dsllelcglplstypssvkllwliqnvdavkqayeegrlafgtvdswliyklnggaqaer
pihvtdstnasrtmfmnlrtlqyddkllgffgidrnkiklpkivpssdpeafgkvatgal
agvpiagclgdqssalvgq

Timeline for d6zq6a1:

• d6zq6a1 first appeared in SCOPe 2.07