Lineage for d6y8ya2 (6y8y A:196-308)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517507Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2517508Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2517600Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2517601Protein automated matches [254721] (4 species)
    not a true protein
  7. 2517602Species Clupea harengus [TaxId:7950] [397942] (2 PDB entries)
  8. 2517604Domain d6y8ya2: 6y8y A:196-308 [397944]
    Other proteins in same PDB: d6y8ya4, d6y8ya5
    automated match to d3pmga2
    complexed with act, ca, g1p, gol, na, ni, sep

Details for d6y8ya2

PDB Entry: 6y8y (more details), 1.95 Å

PDB Description: structure of baltic herring (clupea harengus) phosphoglucomutase 5 (pgm5) with bound glucose-1-phosphate
PDB Compounds: (A:) Phosphoglucomutase 5

SCOPe Domain Sequences for d6y8ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y8ya2 c.84.1.0 (A:196-308) automated matches {Clupea harengus [TaxId: 7950]}
vevylnllrgifdfnaikglltgpdqlkmrvdamsgvmgpyvrrilcdelgapansavnc
vpledfgghypdpnltyatglvdamkggefgfgaafdadgdrcmilgqnaffv

SCOPe Domain Coordinates for d6y8ya2:

Click to download the PDB-style file with coordinates for d6y8ya2.
(The format of our PDB-style files is described here.)

Timeline for d6y8ya2: