Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
Protein automated matches [254721] (4 species) not a true protein |
Species Clupea harengus [TaxId:7950] [397942] (2 PDB entries) |
Domain d6y8ya2: 6y8y A:196-308 [397944] Other proteins in same PDB: d6y8ya4, d6y8ya5 automated match to d3pmga2 complexed with act, ca, g1p, gol, na, ni, sep |
PDB Entry: 6y8y (more details), 1.95 Å
SCOPe Domain Sequences for d6y8ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y8ya2 c.84.1.0 (A:196-308) automated matches {Clupea harengus [TaxId: 7950]} vevylnllrgifdfnaikglltgpdqlkmrvdamsgvmgpyvrrilcdelgapansavnc vpledfgghypdpnltyatglvdamkggefgfgaafdadgdrcmilgqnaffv
Timeline for d6y8ya2:
View in 3D Domains from same chain: (mouse over for more information) d6y8ya1, d6y8ya3, d6y8ya4, d6y8ya5 |