| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (3 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.1.2: Chorismate mutase [55304] (1 protein) automatically mapped to Pfam PF07736 |
| Protein Chorismate mutase [55305] (3 species) |
| Species Bacillus subtilis [TaxId:1423] [55306] (10 PDB entries) |
| Domain d2chtc_: 2cht C: [39792] complexed with tsa |
PDB Entry: 2cht (more details), 2.2 Å
SCOPe Domain Sequences for d2chtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chtc_ d.79.1.2 (C:) Chorismate mutase {Bacillus subtilis [TaxId: 1423]}
mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvlrpdl
Timeline for d2chtc_: