SCOPe 2.08: Domain d6w9gl1: 6w9g L:1-110

Lineage for d6w9gl1 (6w9g L:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6w9gl1: 6w9g L:1-110 [397897]
   Other proteins in same PDB: d6w9ga_, d6w9gb_, d6w9gc_, d6w9gl2, d6w9gm2, d6w9gy2
   automated match to d1dn0a1
   complexed with 1pe, dv7, ete, peg, tmo, trs

Details for d6w9gl1

PDB Entry: 6w9g, 1.82 Å

PDB Description: crystal structure of the fab fragment of humanized 5c8 antibody containing the fluorescent non-canonical amino acid l-(7- hydroxycoumarin-4-yl)ethylglycine in complex with cd40l at ph 6.8

PDB Compounds: (L:) 5c8* Fab (light chain)

SCOPe Domain Sequences for d6w9gl1:

Sequence; same for both SEQRES and ATOM records:

>d6w9gl1 b.1.1.0 (L:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
gvparfsgsgsgtdftltissvepedfatyycqhswexpptfgggtklei

Timeline for d6w9gl1:

• d6w9gl1 first appeared in SCOPe 2.07