Lineage for d6w9gy2 (6w9g Y:111-216)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750029Domain d6w9gy2: 6w9g Y:111-216 [397891]
    Other proteins in same PDB: d6w9ga_, d6w9gb_, d6w9gc_, d6w9gl1, d6w9gm1, d6w9gy1
    automated match to d1dn0a2
    complexed with 1pe, dv7, ete, peg, tmo, trs

Details for d6w9gy2

PDB Entry: 6w9g (more details), 1.82 Å

PDB Description: crystal structure of the fab fragment of humanized 5c8 antibody containing the fluorescent non-canonical amino acid l-(7- hydroxycoumarin-4-yl)ethylglycine in complex with cd40l at ph 6.8
PDB Compounds: (Y:) 5c8* Fab (light chain)

SCOPe Domain Sequences for d6w9gy2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w9gy2 b.1.1.2 (Y:111-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6w9gy2:

Click to download the PDB-style file with coordinates for d6w9gy2.
(The format of our PDB-style files is described here.)

Timeline for d6w9gy2: