Lineage for d6w9gc_ (6w9g C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777270Protein Extracellular domain of CD40 ligand [49844] (1 species)
  7. 2777271Species Human (Homo sapiens) [TaxId:9606] [49845] (4 PDB entries)
  8. 2777274Domain d6w9gc_: 6w9g C: [397889]
    Other proteins in same PDB: d6w9gl1, d6w9gl2, d6w9gm1, d6w9gm2, d6w9gy1, d6w9gy2
    automated match to d1alya_
    complexed with 1pe, dv7, ete, peg, tmo, trs

Details for d6w9gc_

PDB Entry: 6w9g (more details), 1.82 Å

PDB Description: crystal structure of the fab fragment of humanized 5c8 antibody containing the fluorescent non-canonical amino acid l-(7- hydroxycoumarin-4-yl)ethylglycine in complex with cd40l at ph 6.8
PDB Compounds: (C:) cd40 ligand

SCOPe Domain Sequences for d6w9gc_:

Sequence, based on SEQRES records: (download)

>d6w9gc_ b.22.1.1 (C:) Extracellular domain of CD40 ligand {Human (Homo sapiens) [TaxId: 9606]}
npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf
vnvtdpsqvshgtgftsfgllkl

Sequence, based on observed residues (ATOM records): (download)

>d6w9gc_ b.22.1.1 (C:) Extracellular domain of CD40 ligand {Human (Homo sapiens) [TaxId: 9606]}
npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
snrqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfvnvt
dpsqvshgtgftsfgllkl

SCOPe Domain Coordinates for d6w9gc_:

Click to download the PDB-style file with coordinates for d6w9gc_.
(The format of our PDB-style files is described here.)

Timeline for d6w9gc_: