SCOPe 2.07: Domain d6vy4d1: 6vy4 D:2-110

Lineage for d6vy4d1 (6vy4 D:2-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d6vy4d1: 6vy4 D:2-110 [397887]
   Other proteins in same PDB: d6vy4d2, d6vy4l2
   automated match to d1adql1
   complexed with ipa, nag, so4

Details for d6vy4d1

PDB Entry: 6vy4, 2 Å

PDB Description: crystal structure of hendra receptor binding protein head domain in complex with human neutralizing antibody henv-32

PDB Compounds: (D:) Anti-Hendra receptor binding protein antibody HENV-32 Fab light chain

SCOPe Domain Sequences for d6vy4d1:

Sequence; same for both SEQRES and ATOM records:

>d6vy4d1 b.1.1.1 (D:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvltqppsvsvapgqtaritcggnniggksvhwyqqkpgqapvlvvyddrdrpsgiper
fsgsnsgdtasltisrvdagdeadyfcqvwdnasdeavfgggtkltvlg

Timeline for d6vy4d1:

• d6vy4d1 is new in SCOPe 2.07-stable
  
• d6vy4d1 appears in the current release, SCOPe 2.08