Lineage for d6vjki_ (6vjk I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415932Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2415933Protein automated matches [190537] (10 species)
    not a true protein
  7. 2416011Species Streptomyces avidinii [TaxId:1895] [397827] (1 PDB entry)
  8. 2416020Domain d6vjki_: 6vjk I: [397880]
    automated match to d2zsca_
    complexed with btn; mutant

Details for d6vjki_

PDB Entry: 6vjk (more details), 1.6 Å

PDB Description: streptavidin mutant m88 (n49c/a86c)
PDB Compounds: (I:) streptavidin

SCOPe Domain Sequences for d6vjki_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vjki_ b.61.1.0 (I:) automated matches {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgcaesryvltgrydsapatdgsgtalg
wtvawknnyrnchsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
p

SCOPe Domain Coordinates for d6vjki_:

Click to download the PDB-style file with coordinates for d6vjki_.
(The format of our PDB-style files is described here.)

Timeline for d6vjki_: