Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (2 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.2: Chorismate mutase [55304] (1 protein) |
Protein Chorismate mutase [55305] (2 species) |
Species Bacillus subtilis [TaxId:1423] [55306] (6 PDB entries) |
Domain d1comk_: 1com K: [39788] |
PDB Entry: 1com (more details), 2.2 Å
SCOP Domain Sequences for d1comk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1comk_ d.79.1.2 (K:) Chorismate mutase {Bacillus subtilis} mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvlrp
Timeline for d1comk_: