Lineage for d1comk_ (1com K:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33616Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)
  4. 33617Superfamily d.79.1: YjgF-like [55298] (2 families) (S)
  5. 33629Family d.79.1.2: Chorismate mutase [55304] (1 protein)
  6. 33630Protein Chorismate mutase [55305] (1 species)
  7. 33631Species Bacillus subtilis [TaxId:1423] [55306] (6 PDB entries)
  8. 33659Domain d1comk_: 1com K: [39788]

Details for d1comk_

PDB Entry: 1com (more details), 2.2 Å

PDB Description: the monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction

SCOP Domain Sequences for d1comk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1comk_ d.79.1.2 (K:) Chorismate mutase {Bacillus subtilis}
mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvlrp

SCOP Domain Coordinates for d1comk_:

Click to download the PDB-style file with coordinates for d1comk_.
(The format of our PDB-style files is described here.)

Timeline for d1comk_: