Lineage for d1comj_ (1com J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914039Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1914165Family d.79.1.2: Chorismate mutase [55304] (1 protein)
    automatically mapped to Pfam PF07736
  6. 1914166Protein Chorismate mutase [55305] (3 species)
  7. 1914167Species Bacillus subtilis [TaxId:1423] [55306] (10 PDB entries)
  8. 1914211Domain d1comj_: 1com J: [39787]
    complexed with pre

Details for d1comj_

PDB Entry: 1com (more details), 2.2 Å

PDB Description: the monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction
PDB Compounds: (J:) chorismate mutase

SCOPe Domain Sequences for d1comj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1comj_ d.79.1.2 (J:) Chorismate mutase {Bacillus subtilis [TaxId: 1423]}
mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl

SCOPe Domain Coordinates for d1comj_:

Click to download the PDB-style file with coordinates for d1comj_.
(The format of our PDB-style files is described here.)

Timeline for d1comj_: