Lineage for d1comj_ (1com J:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33616Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)
  4. 33617Superfamily d.79.1: YjgF-like [55298] (2 families) (S)
  5. 33629Family d.79.1.2: Chorismate mutase [55304] (1 protein)
  6. 33630Protein Chorismate mutase [55305] (1 species)
  7. 33631Species Bacillus subtilis [TaxId:1423] [55306] (6 PDB entries)
  8. 33658Domain d1comj_: 1com J: [39787]

Details for d1comj_

PDB Entry: 1com (more details), 2.2 Å

PDB Description: the monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction

SCOP Domain Sequences for d1comj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1comj_ d.79.1.2 (J:) Chorismate mutase {Bacillus subtilis}
mirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpaka
vrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqdqirhvylekavvl

SCOP Domain Coordinates for d1comj_:

Click to download the PDB-style file with coordinates for d1comj_.
(The format of our PDB-style files is described here.)

Timeline for d1comj_: